PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04190A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 187aa    MW: 21270.5 Da    PI: 9.3392
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04190AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.83.3e-2662111352
                     RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                k  ++e++s++Fs+pik+AA+eL+v++TvLK++CR + I+RWPhRk+ksl
  Oropetium_20150105_04190A  62 KLFTFEQVSRHFSMPIKQAARELNVGPTVLKKRCRDLDIPRWPHRKVKSL 111
                                5679********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.05244132IPR003035RWP-RK domain
PfamPF020421.5E-2265111IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MISGELDGLS EIDGDFSSVW PQMEDAYRKS MEGDKEVNME CGGVESGKKM QGLLRGSGAD  60
KKLFTFEQVS RHFSMPIKQA ARELNVGPTV LKKRCRDLDI PRWPHRKVKS LQTLINNVQE  120
LGKEDSHRTR AVVEMLQHTK RMMEKKPAAM LDENTKALRQ ACFKEKFKRR RLMAHAVECG  180
WDDSAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167171KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955210.15e-54PREDICTED: protein RKD1
SwissprotQ9M9U98e-33RKD1_ARATH; Protein RKD1
TrEMBLA0A0D9YY636e-52A0A0D9YY63_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HLA46e-52A0A0E0HLA4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NKW96e-52A0A0E0NKW9_ORYRU; Uncharacterized protein
TrEMBLA2X9K26e-52A2X9K2_ORYSI; Putative uncharacterized protein
TrEMBLI1P4806e-52I1P480_ORYGL; Uncharacterized protein
STRINGBGIOSGA005630-PA2e-51(Oryza sativa Indica Group)
STRINGORGLA02G0278600.12e-51(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-34RWP-RK domain-containing protein